HiveBrain v1.2.0
Get Started
← Back to all entries
snippetbashTip

swaks — Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.co

Submitted by: @import:tldr-pages··
0
Viewed 0 times
thecommandcliknifeswaksarmysmtpswiss
linux

Problem

How to use the swaks command: Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.com/jetmore/swaks/blob/develop/doc/base.pod>.

Solution

swaks — Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.com/jetmore/swaks/blob/develop/doc/base.pod>.

Deliver a standard test email to user@example.com on port 25 of test-server.example.net:
swaks {{[-t|--to]}} {{user@example.com}} {{[-s|--server]}} {{test-server.example.net}}


Deliver a standard test email, requiring CRAM-MD5 authentication as user me@example.com. An "X-Test" header will be added to the email body:
swaks {{[-t|--to]}} {{user@example.com}} {{[-f|--from]}} {{me@example.com}} {{[-a|--auth]}} {{CRAM-MD5}} {{[-au|--auth-user]}} {{me@example.com}} --header-X-Test "{{test_email}}"


Test a virus scanner using EICAR in an attachment. Don't show the message DATA part:
swaks {{[-t|--to]}} {{user@example.com}} --attach - {{[-s|--server]}} {{test-server.example.com}} {{[-n|--suppress-data]}} {{path/to/eicar.txt}}


Test a spam scanner using GTUBE in the body of an email, routed via the MX records for example.com:
swaks {{[-t|--to]}} {{user@example.com}} --body {{path/to/gtube_file}}


Deliver a standard test email to user@example.com using the LMTP protocol via a UNIX domain socket file:
swaks {{[-t|--to]}} {{user@example.com}} --socket {{/var/lda.sock}} --protocol {{LMTP}}

Code Snippets

Deliver a standard test email to `user@example.com` on port 25 of `test-server.example.net`

swaks {{[-t|--to]}} {{user@example.com}} {{[-s|--server]}} {{test-server.example.net}}

Deliver a standard test email, requiring CRAM-MD5 authentication as user `me@example.com`. An "X-Test" header will be added to the email body

swaks {{[-t|--to]}} {{user@example.com}} {{[-f|--from]}} {{me@example.com}} {{[-a|--auth]}} {{CRAM-MD5}} {{[-au|--auth-user]}} {{me@example.com}} --header-X-Test "{{test_email}}"

Test a virus scanner using EICAR in an attachment. Don't show the message DATA part

swaks {{[-t|--to]}} {{user@example.com}} --attach - {{[-s|--server]}} {{test-server.example.com}} {{[-n|--suppress-data]}} {{path/to/eicar.txt}}

Test a spam scanner using GTUBE in the body of an email, routed via the MX records for `example.com`

swaks {{[-t|--to]}} {{user@example.com}} --body {{path/to/gtube_file}}

Deliver a standard test email to `user@example.com` using the LMTP protocol via a UNIX domain socket file

swaks {{[-t|--to]}} {{user@example.com}} --socket {{/var/lda.sock}} --protocol {{LMTP}}

Context

tldr-pages: linux/swaks

Revisions (0)

No revisions yet.