snippetbashTip
swaks — Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.co
Viewed 0 times
thecommandcliknifeswaksarmysmtpswiss
linux
Problem
How to use the
swaks command: Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.com/jetmore/swaks/blob/develop/doc/base.pod>.Solution
swaks — Swiss Army Knife SMTP, the all-purpose SMTP transaction tester. More information: <https://github.com/jetmore/swaks/blob/develop/doc/base.pod>.Deliver a standard test email to
user@example.com on port 25 of test-server.example.net:swaks {{[-t|--to]}} {{user@example.com}} {{[-s|--server]}} {{test-server.example.net}}Deliver a standard test email, requiring CRAM-MD5 authentication as user
me@example.com. An "X-Test" header will be added to the email body:swaks {{[-t|--to]}} {{user@example.com}} {{[-f|--from]}} {{me@example.com}} {{[-a|--auth]}} {{CRAM-MD5}} {{[-au|--auth-user]}} {{me@example.com}} --header-X-Test "{{test_email}}"Test a virus scanner using EICAR in an attachment. Don't show the message DATA part:
swaks {{[-t|--to]}} {{user@example.com}} --attach - {{[-s|--server]}} {{test-server.example.com}} {{[-n|--suppress-data]}} {{path/to/eicar.txt}}Test a spam scanner using GTUBE in the body of an email, routed via the MX records for
example.com:swaks {{[-t|--to]}} {{user@example.com}} --body {{path/to/gtube_file}}Deliver a standard test email to
user@example.com using the LMTP protocol via a UNIX domain socket file:swaks {{[-t|--to]}} {{user@example.com}} --socket {{/var/lda.sock}} --protocol {{LMTP}}Code Snippets
Deliver a standard test email to `user@example.com` on port 25 of `test-server.example.net`
swaks {{[-t|--to]}} {{user@example.com}} {{[-s|--server]}} {{test-server.example.net}}Deliver a standard test email, requiring CRAM-MD5 authentication as user `me@example.com`. An "X-Test" header will be added to the email body
swaks {{[-t|--to]}} {{user@example.com}} {{[-f|--from]}} {{me@example.com}} {{[-a|--auth]}} {{CRAM-MD5}} {{[-au|--auth-user]}} {{me@example.com}} --header-X-Test "{{test_email}}"Test a virus scanner using EICAR in an attachment. Don't show the message DATA part
swaks {{[-t|--to]}} {{user@example.com}} --attach - {{[-s|--server]}} {{test-server.example.com}} {{[-n|--suppress-data]}} {{path/to/eicar.txt}}Test a spam scanner using GTUBE in the body of an email, routed via the MX records for `example.com`
swaks {{[-t|--to]}} {{user@example.com}} --body {{path/to/gtube_file}}Deliver a standard test email to `user@example.com` using the LMTP protocol via a UNIX domain socket file
swaks {{[-t|--to]}} {{user@example.com}} --socket {{/var/lda.sock}} --protocol {{LMTP}}Context
tldr-pages: linux/swaks
Revisions (0)
No revisions yet.